PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 322aa    MW: 37010.3 Da    PI: 6.6118
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017517.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.39.9e-5671361129
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++  ++ + e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++s 
  Pbr017517.1   7 VPPGFRFHPTDEELVDYYLRKKVTSRRIDL-DVIKDVDLYKIEPWDLQElcRIGTeEQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAIYS- 102
                  69****************************.9***************954555542556**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrle 129
                  k+ l+g++ktLvfykgrap+g+k+dW+mheyrle
  Pbr017517.1 103 KHDLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                  8899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-615156IPR003441NAC domain
PROSITE profilePS5100559.8737156IPR003441NAC domain
PfamPF023655.0E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
METFSHVPPG FRFHPTDEEL VDYYLRKKVT SRRIDLDVIK DVDLYKIEPW DLQELCRIGT  60
EEQNDWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKAI YSKHDLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GAPQEEGWVV CRVFKKKIAS MRNKMSEHES PCWYDDQVSF  180
MPDLDSPGHN SSSMNMNMVP YHHLPSYPCK KELDHLPFPV PHEHFFQLPL LGSPKLLQSS  240
SATAVSSSNS MAPHAYGIDI NHACTFQPSD QDQNFHGVVY GNSSNDDHQR TVDQMTDWRA  300
LDKFVASQLS QDDASKGNSY S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-50215710169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374491.10.0PREDICTED: NAC domain-containing protein 7-like
RefseqXP_009374492.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-132NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM5X7780.0M5X778_PRUPE; Uncharacterized protein
STRINGVIT_16s0022g00690.t011e-172(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-120NAC 007